PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT29741
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 896aa    MW: 97271.5 Da    PI: 6.4106
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT29741genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.91.3e-30593649259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               +Dgy+WrKYGqK+vk se+prsYY+Ct+++C+vkkkvers+ +++v+ei+Y+g+Hnh+
  EMT29741 593 EDGYSWRKYGQKQVKHSEYPRSYYKCTHPSCQVKKKVERSH-EGHVTEIIYKGTHNHP 649
               8****************************************.***************8 PP

2WRKY34.83.2e-11821842122
               ---SS-EEEEEEE--TT-SS-E CS
      WRKY   1 ldDgynWrKYGqKevkgsefpr 22 
               ldDgy+WrKYGqK+vkg+++pr
  EMT29741 821 LDDGYRWRKYGQKVVKGNPNPR 842
               59*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.63587651IPR003657WRKY domain
SuperFamilySSF1182905.23E-25587651IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.1E-27587651IPR003657WRKY domain
SMARTSM007743.1E-33592650IPR003657WRKY domain
PfamPF031062.1E-23593649IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-13806842IPR003657WRKY domain
SuperFamilySSF1182902.09E-9813843IPR003657WRKY domain
PROSITE profilePS5081115.686816842IPR003657WRKY domain
SMARTSM007746.7E-6821856IPR003657WRKY domain
PfamPF031068.4E-7822842IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 896 aa     Download sequence    Send to blast
MKKQSVQRSM FSTTRVQRQD IECSIGVGAW GHVDLYENYF APDSIFECYL HHFILDAMAI  60
VLEHHKYTTA MRMLAHGMAT YQWDEYLQIC VRTYLEAMVF GPEYLRELNV EDTTRLMAIG  120
ESIGLLEKER EEIEETREGK WCSPLLPRRI GHHWTPPPDL QHVQLSLAGH GAKLRGTFSC  180
TAVTEYIAGP CAGLPASHDT PLSAHLRTSG YSPMSSPPPL GPDKKWDVAL AAATIWGRVL  240
EGSSMSSNMT CLRLGFGGIR VELGCKPLQC SSFVSDPCAL FPLLLVLAIG GLRPSPAGRG  300
GIAIGGSCDS HFSIISPRFH AEMDGHTHLA MEWKDQSPGP DCSMLPSFLT DPFPADPLVE  360
DCDGGNDGSE GGGFERHGLS VAVGSPQEEG KPVTPHFGQR SSSSSSLSER MAGRAGLQTV  420
RIVIGFVSGM LDWQGQSSPT TGKLLMLGDT NNNNNARLEP PSVEDGPRAF SFKALDLKSS  480
QYTAEGKKGS LPNSQHPSAP SRDVPVKTET NIQTTTQGAN PLGHLNQAQL NNGQDLMKRS  540
YHDCNNKRNR LAADSATAGG DNNASPTPPA TAVDSEAAKG DYPAAVATAA PAEDGYSWRK  600
YGQKQVKHSE YPRSYYKCTH PSCQVKKKVE RSHEGHVTEI IYKGTHNHPR PAAQSRRPAG  660
GAQVHPFNDA QMDAPADNNN NGYGNAGGSQ PNAEARSLWH AGVAVQDWRG DGLEATSPPS  720
VPGELCDSSA SMQVHDGAAR FESPEGGVDV TSAVSDEVDG DDRVAHGSMS QGQGAADTTE  780
GDELESKRRK LESCAIDMST ASRAVREPRV VIQTTSEVDI LDDGYRWRKY GQKVVKGNPN  840
PRLPNSPQTS QHTQDAFQTP WKTIHYVTTI SSARLISDQV KDMDNLTLRR LNMHEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-145936521878Probable WRKY transcription factor 4
2ayd_A1e-145926511474WRKY transcription factor 1
2lex_A1e-145936521878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3767650.0AK376765.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3135C08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014751041.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
TrEMBLM8D0Q20.0M8D0Q2_AEGTA; Putative WRKY transcription factor 2
STRINGMLOC_77883.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP207538100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.14e-61WRKY DNA-binding protein 2